DPCstruct | MC24850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 193 ± 35 aa |
| Standard deviation of domain lengths | 34.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1GYG2 | 1-141 | MQYADMPSCMGACEAFDEGTAMDTMGNTLGCRIYHAGAAKMAPEMHCSHAGPAGDGQCGTICDGYCAIVMDACSTAYADDAACMTAC… |
| A0A849Z8X0 | 6-199 | AIAALLGVSALPAFGCNDILGFDERTFDPCVQYCDTIQQTCTQEHAQYQDQETCLGTCALFEAGDPESPTGNTIACRMEAVKRAQTS… |
| A0A2E7CKV5 | 26-297 | None |
| A0A850BAI9 | 34-219 | None |
| A0A356SZW0 | 26-217 | None |
| A0A2E4FBC6 | 49-243 | None |
| A0A4P2QKF6 | 4-217 | None |
| A0A5B8MHC2 | 240-437 | None |
| A0A2M8BYC1 | 7-175 | None |
| A0A356TJ02 | 1-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.