DPCstruct | MC24844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 147 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383RBI2 | 109-255 | NAKWTQEQWGKTIVWGHNGHISKTNTLPFVYPEMSGQHLAKHYGDNYVSIGTSINSGSYNVVNESGKFGPYGTVRIDDPNSINYTVG… |
| A0A7Y5U9V0 | 418-576 | AGSPNVVVIAHNGHVARERVGGIQHPPMGELLAKRLGRRYLATGFLLGNGKFRGQELDPKTGQSPDLRELSLDDIAPGSLEDVLSQV… |
| A0A7J0CWK8 | 161-315 | None |
| A0A3S0D1S0 | 89-247 | None |
| A0A1H0B229 | 109-273 | None |
| A0A7J9ZLI7 | 161-331 | None |
| A0A835XT23 | 646-815 | None |
| A0A094GSH5 | 265-418 | None |
| A0A5B1B444 | 344-503 | None |
| G1VIQ4 | 32-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.