DPCstruct | MC2484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7TCF7 | 2-125 | FKELFEKQAELNKRTGFDAKALRSNFDPKVAGLWINNYIAAMSNELEELRDCTFWKHWCKEAKEGRRFELNDLQNARVEVIDMLFFW… |
| A0A090YSA5 | 1-127 | MTDKLNELFALQSELDNRIISERNIDKSLDEWVVGITLAMESEIDEIRREVNWKWWKNDKPIDKEALQGEVIDMWYFLISLSLKCDL… |
| M1Q1H8 | 75-180 | None |
| A0A0F8YQ18 | 1-139 | None |
| A0A1F2WG37 | 1-140 | None |
| A0A0F9QAL2 | 18-134 | None |
| A0A5C7U8V7 | 21-147 | None |
| A0A7V5RN56 | 1-138 | None |
| A0A0F9HJ51 | 57-198 | None |
| A0A2E6KDF5 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.