DPCstruct | MC24837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 386 ± 36 aa |
| Standard deviation of domain lengths | 35.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9GMC9 | 34-361 | EATADGVATDVAEAWESAPVYVDATQDGIVPSDEAERLAGRVEGHSPAVYLAVVPATALSDQPGDSNRARAEAFLEAVSAAGGPDGV… |
| A0A2S6WC87 | 256-635 | VERVAAGLKQDPVYADPESPRVLDARQLDRLHERIRDFRRSEGGGRVYVSLVPQTPESEAAGDPWLFTAAVHAKVGADGVYIVADPD… |
| A0A6N9H4N9 | 35-401 | None |
| A0A2G4H424 | 7-370 | None |
| A0A505DMB9 | 1-413 | None |
| A0A1X2AD10 | 21-356 | None |
| S0EXM5 | 27-434 | None |
| S3BKN5 | 56-498 | None |
| A0A132N6F8 | 15-370 | None |
| A0A7C3XBF0 | 110-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.