DPCstruct | MC24836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 421 ± 62 aa |
| Standard deviation of domain lengths | 62.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.20 |
| Pfam Score | 69.09 |
| Assigned Pfam label(s) | PF11992- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5D8S2 | 7-477 | TEPQGTERQESGRPVGVLATTAAALLGGAGAAWVIGGVFGGGLARLTAIGGAVLGALIAWASYRTSRPALMQLLAVPAALVAGSLLV… |
| A0A2V9NIF5 | 13-448 | AAAIRRYFDVVLYLLIFTGFGTLASTGSLDFPTVLIVSGALLFRGYILARRLQVILSERWTNLLTIACFALFVADEFVISRTFLASA… |
| A0A7T9EBV4 | 1-419 | None |
| K2G4E4 | 215-640 | None |
| A0A6B0Q4B2 | 10-401 | None |
| E7NRY6 | 9-451 | None |
| A0A554WA05 | 18-353 | None |
| A0A5C1QCV1 | 9-465 | None |
| A0A5C8M369 | 1-331 | None |
| A0A373Q354 | 23-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.