DPCstruct | MC24833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 289 ± 37 aa |
| Standard deviation of domain lengths | 36.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.58 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0291- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9JAS3 | 98-401 | MRTESELRQVAADDLRVAFGLLDARHVAGDASLTMSSRTQLMADWRQGAKKRLPGMAKMTRERWARFGDLAHSTTPDLKEAHGGLRD… |
| A0A2V9NCR9 | 4-284 | VRCAKRRVHNCSARLPEVTRSRHAKYGNTVFHLEPNIKEAPGGLRDYNVACWMALLSAIDQECRWPATESFLPDSTRQLKPALQFLS… |
| A0A7H4SAY9 | 2-257 | None |
| A0A2V8UE77 | 9-265 | None |
| A0A848QFY4 | 1-279 | None |
| A0A7J5UK56 | 2-297 | None |
| A0A538CAJ6 | 7-335 | None |
| A0A7W1UCM5 | 192-414 | None |
| A0A3N5ZRL6 | 121-437 | None |
| A0A2V6R644 | 573-896 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.