DPCstruct | MC2483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 335 ± 68 aa |
| Standard deviation of domain lengths | 68.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.28 |
| Pfam Score | 85.28 |
| Assigned Pfam label(s) | CL0237- CL0333- PF19276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8MPW2 | 12-313 | PVGAGNRALPEEPDEFRLCFERDLDRVKHSRPWRRLAGKCQVFVAPEDDHLRTRLTHAVEVAQVAVGIARAANLCVPLTEAIALAHD… |
| A0A3P9AYL8 | 14-377 | IPDQLHCLRDTPQFQRLRNIKQLGGIYFVYPGASHNRFEHSIGVAHLAGELAKALKVKQLEQINDQDVLCVQIAGLCHDLGHGPFSH… |
| A0A3Q3FHY8 | 57-443 | None |
| A0A1I8IIR1 | 618-979 | None |
| A0A6P6QV20 | 547-922 | None |
| A0A397FLL1 | 3-233 | None |
| A0A453DNC3 | 1-207 | None |
| A0A1Q9CGN6 | 36-503 | None |
| G0PHH4 | 26-302 | None |
| A0A650CIX9 | 19-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.