DPCstruct | MC24826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 153 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498ETH5 | 8-153 | QLHEAYSKYAMSRVSCVFCIMSSEADLMASAGCVDNHEVYVELVELEAESTFGFQGNRWLADVAPHLLPPELRAAIVDAKEKAVLRQ… |
| A0A1G6PSK7 | 152-303 | ELHEAYTKYLMTRVSCVFCIMSSAGDLIASTTCPDNQDIYRTMVELEATSTFAFQSNNWLGDVAPHLLGSELADRLALAKEAARVRE… |
| A0A072TPX0 | 124-285 | None |
| A0A2Z5ACI8 | 16-164 | None |
| A0A810YDH9 | 42-222 | None |
| A0A4Q3QC30 | 1-155 | None |
| A0A1I2I118 | 20-150 | None |
| A0A069PLN3 | 3-148 | None |
| A0A4V2RFR1 | 78-235 | None |
| A0A094X5E3 | 14-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.