DPCstruct | MC24824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498EST6 | 21-133 | MPYQQRWVADTSPLKVIEKSRRTGITWAEASDDVLTAPSSAPAGGMNVYYIAYNQDMTVEYIQACAIWARAFNYAASEIEEGFWEED… |
| A0A376ZVB1 | 46-141 | LGYQRRWFEDESQICIAEKSRRTGLTWAEAGRNVMTAAKPRRRGGRNVFYVGSRQEMALEYIAACALFARAFNQLAKADVWEQTFWD… |
| A0A448F5R1 | 3-126 | None |
| A0A072T9H6 | 1-107 | None |
| A0A7U6KQL3 | 216-339 | None |
| A0A376FBT8 | 1-134 | None |
| A0A554WZN5 | 7-114 | None |
| A0A7U2UZK8 | 20-145 | None |
| A0A2X3D0J6 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.