DPCstruct | MC24823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 46 ± 2 aa |
| Standard deviation of domain lengths | 2.05 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 50.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6CU07 | 3-49 | KIVIIGAGITGLSTAYALLERGYDVTVLDRQRYAAMETSFANGGQIS |
| A0A498EPK7 | 3-45 | QQVIVIGGGVVGLTSAWWLAQAGYRVTLLERAQEVGSGSSYGN |
| A0A249Q5S4 | 304-346 | None |
| A0A6G3HN45 | 3-47 | None |
| A0A4R6YDF5 | 2-48 | None |
| A0A4P0Y9L4 | 3-50 | None |
| A0A378EG68 | 3-50 | None |
| A0A4Q3T228 | 2-48 | None |
| I3UDI8 | 9-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.