DPCstruct | MC24821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 20.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219- PF08411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376U7D9 | 37-178 | MRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNAHDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMK… |
| A0A498EJK7 | 1-143 | LRPEGIEWPTREDGKPSFRLEDLTKANGLVHEAAHDALSDVRATIALARLIRQKQPKLFDFCLELRRKDRVAAEMGLHLEPAQRQPF… |
| A0A7Y0RQD3 | 52-222 | None |
| A0A845S0Q1 | 1-156 | None |
| G2ZNG5 | 412-580 | None |
| A0A0B8PFT6 | 2-171 | None |
| A0A378N6D1 | 14-164 | None |
| A0A447N860 | 73-181 | None |
| L1NWU9 | 144-255 | None |
| A0A812S1N9 | 136-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.