DPCstruct | MC24817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 14.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7MYU9 | 93-224 | KLDVRELGIQFGCVRLIPFVLKGLSLFKERFLAALPVSRRASADFSRPVFTAVAFYLCAKRHKLKIDKLKLIELCGTSESEFASVAT… |
| A0A6H5J8P6 | 101-242 | YTCREIAESVGDKSAGMKAAEELKRYKERFLASYPVRQVSSIDLDGTVYAVAAFYLCAKKLKHPVDKQRLLDLSLVREDEFMAVCRS… |
| A0A7S0RNG9 | 91-249 | None |
| A0A2P5WJL1 | 2-108 | None |
| A0A367KXU3 | 66-196 | None |
| A0A1S8W7Z9 | 1-153 | None |
| A0A1Y1HU87 | 95-235 | None |
| A0A6L2LJ66 | 3-120 | None |
| A0A6B2L7X0 | 65-201 | None |
| A0A6A4ZN61 | 53-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.