DPCstruct | MC24814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848ZQM8 | 36-142 | NDFLIPNLRAKAEGDIKELYFTISGDAHSSGGDIKMKYEDFRFEVLKKDRLGVNKLLTFIGNIFTNDGSNTDKNGYRYGSIYAERDV… |
| A0A519W6X8 | 13-156 | LIEVESGNIQNITFKANGNLRAASGSMTMLYNNLKVKLLSDNIDGEGTKEKGLLSFLANTILVKDENPSKGDPARTANMSTTRINSG… |
| J1FCN5 | 2-120 | None |
| A0A090WY79 | 56-162 | None |
| A0A256WC00 | 40-175 | None |
| A0A3G2G2L3 | 219-324 | None |
| A0A6M6BC05 | 580-694 | None |
| A0A1W1VB28 | 176-301 | None |
| A0A2W4NLQ0 | 112-224 | None |
| A0A519SM62 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.