DPCstruct | MC24813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1EIF8 | 8-101 | LACWQCGSDLSELPIPLSRHDQCPQCFNDLHTCRACRHFDATKVTECFEDRADPPVEKENANFCDFFAPKVDAYQPRNTSKSDAAKA… |
| E1R5I6 | 10-97 | ILPEKIGRSTSCTHCGKEAKVCLNCRFYEKGLQWDCRERIDEPVREKDRANFCGFFAPEVKRTEALGKKDERGGEDAKRAFSKLFSDE |
| A0A1Z8RBE4 | 38-161 | None |
| A0A2M6X1B9 | 5-82 | None |
| A0A1J4UWU3 | 49-139 | None |
| A0A660TCY0 | 3-95 | None |
| A0A3M1VSP5 | 145-243 | None |
| A0A2V7XQA1 | 1-76 | None |
| A0A2E7BH13 | 121-202 | None |
| A0A1H3AFI7 | 114-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.