DPCstruct | MC24811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 180 ± 31 aa |
| Standard deviation of domain lengths | 31.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A254SRQ8 | 15-204 | FHGKEKEALEKALDIRKFEIELYWKRTAYFWAFIVANYTAYFFILAQNDLKHQSLYLTLLSFIGLLLAHAWQLSNKGSKFWQKNWEA… |
| A0A0F9UU05 | 116-266 | EPETREALDLYKIMVQSSEGLVSRRQNVNTFFLTMNGALLTAFGLILQGSGGDKLGALGVAVLALAGVILCGAWRSLITSFGQLNRG… |
| A0A416P7C2 | 2-109 | None |
| A0A1A6KVP5 | 34-207 | None |
| A0A7U5V5R9 | 38-218 | None |
| A0A3C1RFY2 | 30-246 | None |
| A0A1I0SDQ1 | 14-193 | None |
| L1PFS8 | 8-207 | None |
| A0A1T4QV94 | 3-238 | None |
| A0A3S4JUT8 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.