DPCstruct | MC2481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 135 ± 22 aa |
| Standard deviation of domain lengths | 21.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0RZ86 | 2-96 | RKRILLHWEHVDLLKDPVRKVLEADKVLDQALAARGYKGSLGEKLQKAGPRFSDLDAVWRAHKLRNRIAHEPGADISASQSAAAVAA… |
| A0A0G0CCH8 | 7-133 | FIIIFIIADILFAFFIIKKRKKISAKDLKFIKNKWQKIKNIFENDPKSAILEADKVLDLILFKKGYQGSTGEKLKKSAKLFSNLNEI… |
| A0A2M7CHU5 | 20-141 | None |
| A0A0G1D2B4 | 31-181 | None |
| A0A2H0CUX4 | 99-260 | None |
| A0A349D075 | 4-125 | None |
| A0A7C1KT08 | 22-169 | None |
| A0A2D6GWJ8 | 37-201 | None |
| A0A2D6E2J9 | 163-310 | None |
| A0A2G6C3Y6 | 5-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.