DPCstruct | MC24808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0SUY5 | 513-594 | MKGHIHSRHNLGVAEYKDGNYELAVQHWMISAKVGYEKSLNAIKDMFKEGRATKAQYAEALLGYRDAVEEMKSPQREEAKRL |
| K0TAV5 | 1-87 | MRGHVYARYNLGCWEDNAGNYDLALQHCMIAANMGCQVSLNCVKRMLMNCLATKADYAEALRGYQSATEEMQSSDRVEARKMLASYE |
| K0RZL5 | 355-440 | None |
| K0S5U0 | 1-81 | None |
| K0SDT5 | 25-104 | None |
| K0SEK5 | 646-746 | None |
| K0SF99 | 169-269 | None |
| K0SFL7 | 3-74 | None |
| K0SFY2 | 150-242 | None |
| K0SJW5 | 36-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.