DPCstruct | MC24805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 191 ± 30 aa |
| Standard deviation of domain lengths | 30.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 40.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0SGZ6 | 5-187 | MQPRDNKRARLLPTAALDVLGNDLLVRCASYLDADGLAQLGRTSARFGIPQAGQQRSLANETARQRFLLSATDEERSRLPEYDDESD… |
| K0T214 | 1-179 | MRPRDSKRARPLPDPTLLEPLDSDLLLRCASYLNAVGLARLGRTSAAFGTPQAGQQRSLANEAAHQLFRWSVTDEERRCLPKHDDDE… |
| K0R348 | 1-183 | None |
| K0R6I2 | 766-928 | None |
| K0REY0 | 32-231 | None |
| K0R8U5 | 1-181 | None |
| K0SGP8 | 3-180 | None |
| K0TP45 | 42-249 | None |
| K0THY2 | 72-238 | None |
| K0T7J8 | 292-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.