DPCstruct | MC24803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 348 ± 45 aa |
| Standard deviation of domain lengths | 44.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12009 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7RCG4 | 1-287 | MDEVDRQVRKTRRSQKKIKPNTSTDNRVGYKATKVFSNQRVLYGLATHEHWPSGHMLMKVPATQEGASVVLDHILLKDVGVNVSVPR… |
| A0A1Y1V897 | 13-365 | QLNNGCFIQLLGVPLFDNKFFNNIRNENDNIYIKRKTYSNDSSKTVKRRKINNNTYEDHHLIIKKDSSVVMNNFHSYPLRKFLFSVS… |
| A0A085NM92 | 117-478 | None |
| A0A7S0IBM1 | 1-363 | None |
| A0A6P6XZN2 | 75-445 | None |
| A0A815PJS7 | 88-464 | None |
| B7XJU0 | 75-355 | None |
| A0A445JF71 | 23-333 | None |
| A0A2V2WM01 | 81-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.