DPCstruct | MC24800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 157 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6VEW8 | 1-162 | MDSEPFSTSLYKWDTRATAAAAAPHRLQFEHMAIAPPPPPPPQQPSSFPPYCVTTRPPARELLLTLEDFFQPYGIRYTMIAKIAELG… |
| A9P2C1 | 29-206 | MDAEHFPVGFFRWDQRPAPAAAAPAATTTVFNKDHGRPLEIILPMNGRKELKSLEDLFREYGVRYSTLAKMTEMGFTANTLVNMTEE… |
| A0A2N9HWF0 | 1-150 | None |
| A0A6V7P0G7 | 9-173 | None |
| A0A5N5K4A0 | 1-144 | None |
| A0A835IM57 | 1-168 | None |
| A0A4D8ZXL4 | 1-137 | None |
| A0A2R6WBS9 | 26-178 | None |
| A0A199UF38 | 18-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.