DPCstruct | MC2480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H7ELW4 | 3-129 | ITEIDLQCEDIIWFGIDKNNYVFECTSAGCGNVPESVCKSKENTKLLESFFLNNLNEEEKNKLPELSIALSQKGIFCYDIYSENERL… |
| A0A7W8DQF4 | 47-183 | KSAVDCLGWEFDWFCVDRHGFMAVLTTAARGHIPESFFQTSAQEYNVIISVLASRETCKGMRVTTESGKLSDWEVYSQHGLFAFDFQ… |
| A0A0A2MG56 | 8-154 | None |
| A0A7G7M6V4 | 5-122 | None |
| A0A0Q8CR70 | 1-121 | None |
| A0A1I6BDC8 | 6-129 | None |
| A0A855G913 | 14-158 | None |
| A0A4P5YPY2 | 19-126 | None |
| A0A845X0R1 | 146-297 | None |
| A0A0K1QFL7 | 73-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.