DPCstruct | MC248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 227 ± 30 aa |
| Standard deviation of domain lengths | 30.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03988 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1HZ00 | 18-281 | TTGSVRKKLPEVTPAFWVMKIAATTLGETAGDLFAQTLKLGYFLTTIVLFLVFVVTLVVQLRSSRYHPFFYWTVILSTSMAGTTMSD… |
| A0A1B2FEY1 | 9-252 | LNKVPEVTLAFWIIKIMSTTVGETFADFLAVDVGWGLGITSAVMALLLFGALILQMRKPSYEPWIYWLSVVLVSILGTQITDILTDV… |
| A0A2G7C5C0 | 330-573 | None |
| A0A368WJH0 | 11-259 | None |
| Q0ZUJ6 | 47-285 | None |
| A0A011U1Q9 | 2-222 | None |
| A0A813KIP0 | 14-211 | None |
| A0A4Q0Q9W7 | 2-204 | None |
| A0A1M5ISY8 | 5-222 | None |
| A0A421FP61 | 4-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.