DPCstruct | MC24798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10494 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7QMM8 | 40-134 | ECELVRGGWLTMRDESSFWFAVPGMGGFDAQRRKGAAELLDLLRKTPFKEMLLNKLEGRSMKKSCFTAQWHVRDLVGGGPLETIETS… |
| A0A7J6VCG0 | 571-671 | EHVSLLINAGLLTRQLIDPNMYWFAIPNIGSVLKGLSQGRKELMSFLNRRKFKEMMLALLEKKRLRMSPLDMRFHLRDLIGSGKLKT… |
| A0A7M3RPS8 | 29-124 | None |
| A0A067CGN9 | 22-120 | None |
| A0A2C5ZZ55 | 8-110 | None |
| A0A674GTW0 | 643-740 | None |
| S4RKG9 | 8-95 | None |
| A0A835Y5H7 | 526-601 | None |
| A0A6I8P9Z1 | 122-244 | None |
| A0A1E7FD66 | 353-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.