DPCstruct | MC24797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384KGU5 | 1-103 | MENENGDDWREEVFQKLRSMRERYLPHVTDVYQRLADKLNHEESLPQQQRSKHFDKFQSMKTNIEQLIQVLSLRKRNIMPILKDCRW… |
| A0A7J6V9F7 | 54-163 | TTQSGQVNTADWQEETYQKIKAMKEIYLPDLHKMHQKLSLRFQQHETVTQRTKEEIDKLRLMKTYLERIITFLQVSKSNIPFTHRDK… |
| A0A2G5EPY8 | 3-112 | None |
| A0A6P6FT26 | 210-353 | None |
| A0A836AR16 | 27-141 | None |
| A0A1J6IKR2 | 35-153 | None |
| A0A1J6IPB0 | 1-105 | None |
| A0A2N9G9F9 | 89-216 | None |
| A0A5E4ESR2 | 573-703 | None |
| A0A6J0PPR2 | 563-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.