DPCstruct | MC24796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6V7A2 | 1-101 | MGEQFRRICKASGARVHIDTANARDSLYRASVDFVLNSCSSSASTSTIPQIDDEDPRQFLSGLANSIELQNIHATRIVSAAVAARTR… |
| A0A4Y7IIA4 | 15-112 | IIQFRRTCKNSGAKVLIETTNARDSFYRASVELVLNSCSRSTYDSAAILIDGESPQNFVAGMAFNLGLDTVRAARIVSASVASRTRS… |
| A0A452XCQ4 | 1-117 | None |
| A0A4S8IER5 | 282-395 | None |
| A0A6A6LHZ8 | 1-99 | None |
| A0A151U7U8 | 170-285 | None |
| A0A6I9RY18 | 310-423 | None |
| A0A7J6WU15 | 134-247 | None |
| A0A287ERF7 | 95-208 | None |
| A0A836Y4Z7 | 255-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.