DPCstruct | MC24795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 108 ± 22 aa |
| Standard deviation of domain lengths | 21.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.75 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | PF00067- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A221V437 | 1-51 | MKIAILTLGTQGDVQPFAILGEALMKRGHQVTLSTAKNFSGLVESYGIDFL |
| A0A7J6V6V7 | 15-113 | EFEIPGDLKADGLDFGTDVCSETVDEPLDPTDLQYVPPLQIVILIVGTRGDVQPFIAIGKRLQDYGHRVRLATHGNFKEFVLTAGLE… |
| R8BT37 | 29-141 | None |
| A0A816BD34 | 2-76 | None |
| L2G940 | 87-192 | None |
| A0A178ABK3 | 23-127 | None |
| A0A383WES8 | 9-126 | None |
| A0A162RUJ4 | 124-240 | None |
| R1G5T4 | 80-238 | None |
| A0A820A3J8 | 3-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.