DPCstruct | MC24794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 6.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6V5T3 | 1-102 | MKCRLPATVRCLSHPSAHVRALSTSVLRDILFLGPIKFNVKQEKRFNGVQGPSHQCLSSSIIDWNKDIEKCLTWEARSRHTTGVSTI… |
| A0A6A4R5T9 | 85-182 | LKRRLPVTIRCLSHPSAHARALSTSVLRAVLRIISIRSSLYPPRKNGIHDQCFNLNFIDWQAHIEKCLTWEAHSRLGNGLSIEFLDT… |
| A0A1D6MJ90 | 533-636 | None |
| A0A7J7GSS0 | 827-928 | None |
| A0A0A9NUH0 | 1-116 | None |
| I3SCI8 | 236-336 | None |
| A0A2G2VH33 | 133-234 | None |
| M1BMC0 | 782-883 | None |
| A0A484LE76 | 697-786 | None |
| A0A2P5YK35 | 705-803 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.