DPCstruct | MC24793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2TTE5 | 1-64 | MAFSEFRPLDEKSLIEYIKATPSLSSKIVDNYDGLKIKEVGDGNLNFVYIIVAPSGSFVIKQAL |
| A0A7J0EVD9 | 1-62 | MASGGFRPLDEKSLVEYIKATPSLSSKLGNPLDDFQIKEVGDGNLNFVYIVIGRSGSLVIKQ |
| W1PMC0 | 2-62 | None |
| M7ZGD9 | 1-57 | None |
| A0A1U8KPM8 | 76-139 | None |
| A0A0D9WAY2 | 1-71 | None |
| A0A7H9UQ50 | 2-61 | None |
| A0A388L4Y5 | 629-694 | None |
| A0A5B6X345 | 39-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.