DPCstruct | MC24790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 151 ± 19 aa |
| Standard deviation of domain lengths | 19.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF01997- PF13821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6UUK0 | 2-140 | EKQFDEFRIKLEESGNLREKIRAVSMEMESAIRIMQSGLLMVHESRPIPEIVEKANVQIVVLKKLYGVLADILKDYPGQYYRYHGDW… |
| R1FTZ2 | 5-138 | EYIESLKEKFREFENKKDKIIELGIKLNRTSKSIIYSVIRGDIKSANEYMVEMDKYKEEIDKIVREEPRLYNNALINYQEYAEAKIF… |
| A0A3D8SJN1 | 245-404 | None |
| A0A101XCD1 | 5-138 | None |
| A0A7S2RGZ0 | 176-319 | None |
| A0A4Y7LDR5 | 29-169 | None |
| A0A7J7QV40 | 1-167 | None |
| A0A2B4SNQ0 | 1-173 | None |
| A0A4U0VYE4 | 1-138 | None |
| A0A2K5VL35 | 4-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.