DPCstruct | MC2479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428WH43 | 9-107 | TNHYNAYIHDGIPPLRKLGYNPTQFLEMVHAAGDAVQATKRLLASPRHTSYGFQRLYALGRLVDSVEFAALLPWFEPLFTADEREEA… |
| A0A7W8DPC2 | 3-112 | DTPSPQEETDRLCVALHKRLTQLFFDVSTESDGSYKPNYMRKQVGDLGGYDAACNLVMCTGGTSGFHKLIGLQLPKLTVEYIILTGP… |
| A0A219B833 | 24-124 | None |
| W5W186 | 11-107 | None |
| A0A7V8F3R5 | 3-107 | None |
| A0A0Q6FRT1 | 3-97 | None |
| D2QLF7 | 45-155 | None |
| A0A1G0ZK18 | 2-90 | None |
| E9S0A4 | 3-89 | None |
| A0A522UXZ9 | 102-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.