DPCstruct | MC24789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0TXJ8 | 263-377 | PKKVDIVHVLDQATAGAVIAIALVFMKTHDKMVANKIDIPDTLPQFDYVRPDIFLLRTLAKHLIMWDKIDANDDWIKANLPVEYRAD… |
| A0A7J6UUJ3 | 1-119 | MMDGTSANVDVTAPGAIIALTLLFLKTESEVVASRLSIPQTHFDLQYVRPDFIMLRVIARNLIMWSRVQPSKDWVQSQVPEIVKTVT… |
| A0A287FTW9 | 11-131 | None |
| A0A7R8XBV7 | 884-1011 | None |
| A0A821I368 | 251-366 | None |
| A0A6P3YD54 | 2-98 | None |
| C1H5G0 | 1529-1643 | None |
| A0A6V7X934 | 131-256 | None |
| A4I5M6 | 1532-1649 | None |
| A0A1D6M2K7 | 1203-1321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.