DPCstruct | MC24787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 223 ± 50 aa |
| Standard deviation of domain lengths | 49.91 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 35.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5NGD4 | 18-187 | LVAATVGPVSGCDGKSPEECTSGEDEDQDGRIDCDDDDCWIDGGVCVEVCDTVFDEDGDGAEGCDDPDCWVAGGGCDEICDGEGDED… |
| A0A2N2HCF3 | 44-283 | MGLAMGLGCSGSVEKPAEDAEVCDNGTDDDDDGKIDCADSDCADFAGCTSSALYAAPASEDCGNGTDDDGDGKVDCSDGDCGSYAGC… |
| A0A2E6ERF0 | 43-191 | None |
| A0A661NRF9 | 61-330 | None |
| A0A7X7FS87 | 300-447 | None |
| A0A521UC79 | 441-580 | None |
| A0A521U4Z0 | 28-263 | None |
| A0A7C5J1Q1 | 6-245 | None |
| A0A3M1DXH9 | 762-897 | None |
| A0A3M1D2Q6 | 37-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.