DPCstruct | MC24785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 16 aa |
| Standard deviation of domain lengths | 16.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7RRV5 | 9-98 | AALAWAAGPAMAAQEACVEVEVNGARAPSYSCLTQQLAPASTGRAQRPVTLGAEVIAGQPSNQLGLYNRAATSHRMGNTFGTSVLPQ… |
| H1S6D5 | 4-81 | AAASCVEVEVNGARAPSFPCLTQKLSPKPAPGQAPSERKLASESIVERPSNALGLFNYSATSHRMGNTFGTSVTPQRP |
| F4GVV9 | 11-115 | None |
| A0A318DVB5 | 14-121 | None |
| A0A1X7H4M2 | 29-135 | None |
| A0A0B4XUX3 | 1-81 | None |
| A0A239LG08 | 106-238 | None |
| A0A7Y8F1U6 | 31-173 | None |
| A0A1H6JE24 | 8-112 | None |
| A0A2E2QU50 | 10-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.