DPCstruct | MC24784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 68 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5X7E9 | 1-45 | MKEFMQTNPDCKEFTDQCSICTVADGKAECSTPQIACVKQAYQCT |
| A0A7W6WBN5 | 1-62 | MAADAPSAEEQSMADFIKTTPGCLEFSDQCSICAMVDGKAECSTPKIACVKKPYVCTKRADN |
| A0A436SJ79 | 15-71 | None |
| A0A0X7A2U0 | 8-53 | None |
| A0A0Q6ZHW4 | 1-76 | None |
| A0A363TGC4 | 4-90 | None |
| A0A3D2PSY2 | 1-65 | None |
| A0A4S0K4H6 | 17-72 | None |
| A0A432UZD2 | 9-71 | None |
| A0A6B8M5L7 | 3-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.