DPCstruct | MC24783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6HK52 | 2-74 | KPFAKPVSIFVGLGFPRDVETVDEAFEILNEWVGSRSPTHEQALAAARTALTEGNVAVARLAFEAFARKTGIL |
| A0A7W6RKU3 | 1-90 | MNWHKFGAFAPLMLVMNGSEKYRLVKSVGDAAEALFASWPLDDGEEYLVAVKTCLEALHGTASPAEARSALIRAAEEAGIPVITVVH… |
| A0A1L3SQF4 | 2-79 | None |
| A0A7W5Q572 | 109-189 | None |
| A0A442VB05 | 344-422 | None |
| U1XH74 | 27-115 | None |
| A0A4Z1Q1J0 | 1-84 | None |
| A0A7Z6QSS9 | 1-98 | None |
| M5FGG3 | 201-276 | None |
| A0A3S3RRF8 | 59-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.