DPCstruct | MC24780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 234 ± 31 aa |
| Standard deviation of domain lengths | 31.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14808 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4GTI4 | 19-227 | PGDEPKFPHVPATLRSVWYLTPRQHAMETVCYVMIFAPMCYVALKQALNHSKWKNQRPIRAPTALDGVLGAITMSSFLGVCYYKAHS… |
| A0A7M3R9B6 | 6-234 | FIKDGVDFSVSGVGGVHCLQYLSLRQKFLESVFYCILSLCGIFWALPKLNPPFDSPLVTRNLQTRNSLLCAHCIVFGIEVGFKFATS… |
| A0A0X3P524 | 6-172 | None |
| A0A2C9JI42 | 14-257 | None |
| A0A834Y1E4 | 1-206 | None |
| A0A7M5UWM6 | 21-266 | None |
| A0A7R8X676 | 13-243 | None |
| A0A6A4KF59 | 623-834 | None |
| A0A0R3TN81 | 26-269 | None |
| A0A482SK37 | 7-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.