DPCstruct | MC2478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5KLJ8 | 2-78 | HQFDDLMISEEENYALGIERTTGRKYVSVDVIDGDAVCALHYEISEDEFVRLLDDPAAGQALARRCRAGEEEARAFR |
| A0A7W7YJV7 | 1-88 | MFFRPLHTFKDEMLSLDRDLETGLRYLCIPVFDGNVQSSEHYALTAEEFDLLTVDAAAREAMAGRCRARLEDARLAEPPVLPRGEPCL |
| A0A285DS03 | 10-98 | None |
| G7GZT3 | 1-83 | None |
| A0A542Y3T4 | 133-216 | None |
| A0A4U0QE33 | 1-77 | None |
| A0A560H4E4 | 32-122 | None |
| A0A1M3LQX9 | 1-67 | None |
| A0A7W8CCS5 | 73-172 | None |
| A0A1G4VA39 | 110-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.