DPCstruct | MC24779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 272 |
|---|---|
| Mean domain length (aa) | 251 ± 55 aa |
| Standard deviation of domain lengths | 55.12 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 81.85 |
| Assigned Pfam label(s) | CL0023- PF01576- CL0220- CL0680- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3R4P2 | 444-690 | YVRALSTAEKTSESRSRSLTLSMQFKRSLERLLQIINGCHPFFVRCIKPNELKLPNCFDRELCVRQLRYSGMMETIQIRRLGYPIRY… |
| A0A287GFJ0 | 1-200 | METLSSTEPHYIRCVKPNNLLKPATFENINVLQQLRCSGVLEAIRISCAGYPTRKLFRDFLQRFRILAPEILKERNDEKVICQKILD… |
| A0A1V9YDV0 | 556-836 | None |
| A0A0R3U9F1 | 25-290 | None |
| K3WUY8 | 1-235 | None |
| A0A7R8XGQ2 | 330-568 | None |
| A0A7R8XEG2 | 56-323 | None |
| A0A7S2XMM1 | 951-1248 | None |
| A0A821BK61 | 1-124 | None |
| A0A2G8LAA2 | 355-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.