DPCstruct | MC24778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 139 ± 24 aa |
| Standard deviation of domain lengths | 23.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.94 |
| Pfam Score | 98.63 |
| Assigned Pfam label(s) | PF17846- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821HM76 | 1-125 | MNGIIHQCSHPNDDDVHFRITDDKIFADIFHYLEVLFRTPQKKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEEKIKKALEKGEVLP… |
| A0A7M3R425 | 1-114 | MGVPKFYRWISQRYPCINQLVKENEVAPIDHFYLDMNGIIHTSSHCEDMAFKAFDEAKVFANIENYITYLVTLMKPLKTLYLAVDGV… |
| A0A834TB40 | 1-118 | None |
| R1CPP9 | 34-145 | None |
| A0A6C0JLT1 | 1-125 | None |
| C1E0G9 | 1-138 | None |
| C1N8M8 | 76-258 | None |
| U6LJ00 | 1-131 | None |
| L1LER9 | 441-636 | None |
| A0A6A2YS11 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.