DPCstruct | MC24776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.09 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF12038- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3QQH9 | 2-135 | AALTQETSTASILVIEAFYGGSHKQLVDTIRELLSQTVLGTHTAGGGDSDVCVVTLPPTKWHWRARTGALALAALIPKHADHGFRTV… |
| A0A493T6L0 | 2-116 | TVLLIEAFYGGSHKQLMDLLQEELKEDCVLCTLPAKKWHWKARTAALYFMQTVPTNPNYRILFASSVLNLAELAALRPDLGKLKKVL… |
| A0A1Y1LJP0 | 20-158 | None |
| A0A3Q2CKW8 | 2-98 | None |
| A0A158RE90 | 318-450 | None |
| A0A6A5EZ55 | 330-453 | None |
| A0A2P8YI66 | 1-130 | None |
| V5WGA4 | 39-169 | None |
| K1P0X3 | 1-124 | None |
| A0A077Z3Z8 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.