DPCstruct | MC24775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 162 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654GJQ3 | 22-200 | AHVCGSPTYDLCEGQHTECNAVSYRVEDQTKGSGCRTACAKKRGELNDKMTGYFCETENKPCTKYDVFGRKGYADNFKRHVMCVKLC… |
| A0A7M3QMJ3 | 61-234 | AYELCEGEHKGCTSVSYREEDETKGSGCRQACARQRENLNEISKAYFCEESDKPCKVYDVYGRSGYDKTFERHVMCVKVCHLSGKAQ… |
| A0A654GIT0 | 99-238 | None |
| A0A654HQV0 | 19-202 | None |
| A0A654HQF6 | 36-218 | None |
| A0A654HER4 | 22-175 | None |
| A0A7M3S0Q0 | 13-145 | None |
| A0A7M3RQ99 | 18-175 | None |
| A0A654H6S6 | 8-178 | None |
| A0A654H410 | 301-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.