DPCstruct | MC24773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 441 ± 89 aa |
| Standard deviation of domain lengths | 88.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.70 |
| Pfam Score | 69.17 |
| Assigned Pfam label(s) | PF06761- PF21070- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5I802 | 2-291 | AKSIVSGEPNDLSQAMKNTDTILQKLDPESIEAVSPLLIEPWMIAMRGVLERAKAEASKRWEADIYQACQRNVEGRFPFRAGGGDAP… |
| A0A7X2BFU8 | 498-1032 | LTLNYPLNDTLVAQARQALRSESLASVVYRMLREQAHTLAPYSFDQHLGPQGSVFSGAGYVIPGFYTQQGYKQYFSVQGATLVSDIL… |
| A0A0C5W4G9 | 873-1272 | None |
| A0A444IQ93 | 8-289 | None |
| A0A2D8A8U2 | 15-441 | None |
| A0A6N6IK60 | 162-535 | None |
| A0A1I3NGR2 | 310-866 | None |
| A0A661KXF3 | 47-583 | None |
| A0A4R2Z5S1 | 177-781 | None |
| A0A501WIK9 | 336-825 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.