DPCstruct | MC2477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 93 ± 4 aa |
| Standard deviation of domain lengths | 3.64 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2X4X4 | 35-134 | DEQLYKETIIILNKILALHDKNSDFIYSGLEDYDDLKQTISVYKESLIKYNFETILKLRSDFAPTGLFQELSIQNEWTEAYTELVDK… |
| A0A7W7YH27 | 13-103 | RLSKAQQRLIEVLEQTKLYIAQSEESIYSPFTLTEIASDLSRAIESLKAGHSIDTSLLQMHFAPASSIQETALNAGWVDPYLDLSRQ… |
| A0A7W0HZR3 | 34-125 | None |
| C6CZ32 | 3-96 | None |
| A0A6B4QPN5 | 3-91 | None |
| A0A848VCC2 | 11-96 | None |
| A0A554UNT1 | 8-99 | None |
| A0A0J6K9N7 | 19-111 | None |
| A0A842TA44 | 19-116 | None |
| A0A4V1UNU5 | 3-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.