DPCstruct | MC24769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 132 ± 33 aa |
| Standard deviation of domain lengths | 32.71 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 93.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N2R6J3 | 286-407 | RLAGKYLLELLKMDLKPRDIITPKSLRNAMVIVMALGGSTNAVLHLIAIARSFGINLTLDHFQKVSDEVPFLADLKPSGKYVMEDVQ… |
| A0A7X1W4F1 | 17-117 | AAFENAIAVASALGASTNCPPHLIAIARHSGIDLSLDDWQRVGEDVPLLVNCMPAGEYLGESFHRAGGVPAVMHELDKVGRLHRDCL… |
| A0A840NW28 | 130-265 | None |
| A0A840NQR1 | 2-77 | None |
| A0A066VG21 | 247-369 | None |
| X7Y9K2 | 2-104 | None |
| A0A378AA27 | 148-268 | None |
| A0A7S4E837 | 286-407 | None |
| R9P8I1 | 464-589 | None |
| H0ESC2 | 130-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.