DPCstruct | MC24766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827S1L3 | 26-163 | MRIIKMYNSMLANISTKSDIQPPYITGLLDNVERALDKINILIDKERVYDGETLAELITENKILSSRESKENLIGLFTGRHKYTLLQ… |
| A0A221DLV2 | 9-138 | NELEFSVIHPQSITGILDEVESALCKINKRLDAAEKIINSEELAKLIIDEKILTVRECRQNLVSYLNEFTLYNCILNLNYIKPYLTL… |
| A0A828B3G1 | 1-137 | None |
| A0A2A3UFA6 | 390-529 | None |
| F5NR83 | 285-420 | None |
| A0A2X2YWC8 | 2-143 | None |
| A0A827UTD3 | 218-357 | None |
| A0A379GPR8 | 116-255 | None |
| A0A8B1C8A3 | 2-174 | None |
| A0A4Q6HM13 | 77-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.