DPCstruct | MC24760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 54.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9W2Z7 | 281-370 | QDLLSDFYQPCVMDCKIGVRTYLEEELSKAKEKPKLRKDMYEKMIQIDPNAPSDEEHRAKGVTKPRYMVWRETISSTATLGFRIEGI… |
| A0A0L8FVG7 | 3-76 | VKMGIRTYLEDELKKARENPKLRSDMYEKMVDIDPSAPTPEERELGAISKPRYMQWRENISSSSSLGFRIEGVK |
| A0A183NLQ7 | 1-93 | None |
| A0A3Q0IJY5 | 183-251 | None |
| A0A7S1FFC6 | 95-178 | None |
| A0A4U5UE09 | 568-656 | None |
| G1KFD5 | 435-536 | None |
| A0A2I0U4U9 | 243-332 | None |
| A0A3B5M0A9 | 106-201 | None |
| A0A1I8HYE2 | 150-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.