DPCstruct | MC2476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 285 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356N5K6 | 2-300 | LVGIIISLVYYGKKSIKLASILAGIGWGFFIDEIGKYLTRDNNYWFRPAIIFIYISFILLFFLYRFLEKKSRQTRSSLWHEILEDCE… |
| M7A4S6 | 62-355 | MMLALVAGWMFLGPTARAVTILLGGIGFGLFLDEVGKFVTKDNDYFYGPAAEIMYVLVLLILVIGRAVRDLRKPSAAEALANAAAIA… |
| A0A3N5VGW6 | 139-432 | None |
| A0A7C4KFW7 | 36-330 | None |
| A0A1E4NYB1 | 2-239 | None |
| A0A542EE52 | 4-314 | None |
| A0A6J4NGN3 | 65-371 | None |
| A0A366ZQM5 | 2-247 | None |
| A0A6G9D2V1 | 7-253 | None |
| A0A2W4S4M4 | 81-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.