DPCstruct | MC24754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355J067 | 368-503 | EIDIKELVEYGKKKNVGIILWAGYWAMDRDMENVCRIYSEMGVKGFKVDFMNRDDQAMVDFYYRCAATAAKYKMMIDFHGAYKPTGL… |
| R9GTM6 | 1-146 | MEEITNYAKQKGVEMIMHNETGGSATNYDRHLDTAFRFMNKYSYNAVKTGYVGQITPRGEHHDGQWMIEHFVRVAEKAAQYQVMVNM… |
| A7LRR2 | 873-1032 | None |
| A0A6L7UG80 | 562-691 | None |
| A0A1Q9VM18 | 417-565 | None |
| A0A3N5L7U0 | 938-1080 | None |
| A0A3D2CKT1 | 600-734 | None |
| A0A359I7M1 | 644-803 | None |
| R5DLC0 | 935-1091 | None |
| A0A2D5DLZ0 | 183-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.