DPCstruct | MC24752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 22.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1V5C5 | 69-237 | SRVYSKEITDTVLWLLTPAPAGATPKGIEEFIRGIAVHMVATLDASLQEADTMKSELFRELENGRLVRLMAKLGTINERQEFDGDRA… |
| A0A137QTC2 | 46-200 | GPLVAFAEGCWDYDPSQRPTAAEALQILIKLNVTDERPSMGEELALFEAAKGGREEVNIDYGHILSLVHKWSYIVQLASAIRMEEAM… |
| A0A183W8J7 | 4-146 | None |
| A0A556TWK9 | 555-669 | None |
| A0A4V5NBB9 | 598-765 | None |
| A0A2V2VFH0 | 7-169 | None |
| A0A7S1UPR8 | 164-330 | None |
| C9SBW3 | 277-433 | None |
| A0A821UWC1 | 218-332 | None |
| A0A7J8DYR9 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.