DPCstruct | MC24750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 235 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A137Q596 | 1-262 | MREGHLLPILISILISLMTEMYTTKYDPQKNRIAPDLSDGHFIHNKQRGGNTITDFWTCKGEVEVKDSDTLGYFIHYDCELCDSVDF… |
| A0A4Y7Q3I7 | 150-363 | VREGHLLPITMAVCMAILTEIYTTTSAAGSKEKRLRFHYRSTPISDFGIAVGSADVKNQDKLAYWLPNGEFMKGQDPDEHCWIYFTT… |
| A0A409W4D2 | 3-245 | None |
| A0A4Y9ZCZ6 | 394-607 | None |
| A0A137QXT5 | 297-541 | None |
| K5WPA2 | 9-245 | None |
| A0A4Q2DGF5 | 82-319 | None |
| A0A409X8L9 | 67-292 | None |
| A0A0C3KQ27 | 75-297 | None |
| A0A137QQ70 | 222-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.